PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016487461.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MYB_related
Protein Properties Length: 94aa    MW: 10787.2 Da    PI: 7.1885
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016487461.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding30.77.3e-102264145
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45
                     ++ ++++E+ l+++ +++ G + W++Ia +++ gRt++++  + +
   XP_016487461.1 22 KLQFSEDEEMLIAKMFNLVGQR-WSLIAGRIP-GRTPEEIEKYCN 64
                     6789*****************9.*********.******988765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007171.9E-52169IPR001005SANT/Myb domain
PfamPF002498.4E-92364IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.6E-112465IPR009057Homeodomain-like
SuperFamilySSF466891.4E-72465IPR009057Homeodomain-like
CDDcd001674.15E-72564No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 94 aa     Download sequence    Send to blast
MRSGSDTICN SPTETTTEET SKLQFSEDEE MLIAKMFNLV GQRWSLIAGR IPGRTPEEIE  60
KYCNSRYVIH KPAKCLKISS SVNEERRKFE NNLS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016487461.16e-65PREDICTED: MYB-like transcription factor ETC1 isoform X2
SwissprotO220591e-16CPC_ARATH; Transcription factor CPC
TrEMBLK4CFE81e-24K4CFE8_SOLLC; Uncharacterized protein
STRINGSolyc07g052490.2.13e-24(Solanum lycopersicum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G46410.16e-17MYB_related family protein